.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kts

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the protein NP_415897.1. To be Published
    Site JCSG
    PDB Id 2kts Target Id 396279
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS25412,NP_415897.1, PF03724, 326144 Molecular Weight 12701.92 Da.
    Residues 116 Isoelectric Point 5.64
    Sequence vtpeqlqhhrfvlesvngkpvtsdknppeisfgekmmisgsmcnrfsgegklsngeltakglamtrmmc anpqlneldntisemlkegaqvdltanqltlatakqtltykladlmn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kts
    1. The J-UNIO protocol for automated protein structure determination by NMR in solution
    P Serrano, B Pedrini, B Mohanty, M Geralt - Journal of biomolecular , 2012 - Springer
     
    2. Evolutionary and functional insights into Leishmania META1: evidence for lateral gene transfer and a role for META1 in secretion
    V Puri, A Goyal, R Sankaranarayanan - BMC Evolutionary , 2011 - w09.biomedcentral.com
     
    3. Determining Protein Structures from NOESY Distance Constraints by Semidefinite Programming
    B Alipanahi, N Krislock, A Ghodsi, H Wolkowicz - 2012 - hal.inria.fr
     
    4. Protein structure by semidefinite facial reduction
    B Alipanahi, N Krislock, A Ghodsi, H Wolkowicz - Research in , 2012 - Springer
     

    Protein Summary

    The NMR structure of the protein NP_415897.1 exhibits a Pilot Secretin MxiM fold[Ref][Ref] (PDBs ID 1Y9T, 1Y9L and 2JW1) with an additional alpha-helix, alpha-1, blocking the putative phospholipid binding cavity formed by the beta-barrel and preventing the interaction with the hydrophobic chains of lipids.

     

     

     

    These results indicate that NP_415897.1 and other members of the PF03274 pfam family may be involved in the assembly of the secretin complex in bacteria, which translocates virulence factors to host cells[Ref].


     

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    3. (No Results)

       


      Discuss this publication
    Tag page

    Files (1)

    FileSizeDateAttached by 
     Pic_PX7069A_TOPSAN.png
    No description
    788.42 kB01:49, 19 Feb 2010PedroSerranoActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch