.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kys

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title NMR Structure of the SARS-CoV Nonstructural Protein 7 in Solution at pH 6.5. J.Mol.Biol. 402 619-628 2010
    Site JCSG
    PDB Id 2kys Target Id 355937
    Related PDB Ids 1ysy 
    Molecular Characteristics
    Source Sars coronavirus tor2
    Alias Ids TPS1354,29837500 Molecular Weight 9267.33 Da.
    Residues 83 Isoelectric Point 5.18
    Sequence skmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsvllsmqgavdin rlceemldnratlq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kys
    1. NMR Structure of the SARS-CoV Nonstructural Protein 7 in Solution at pH 6.5
    MA Johnson, K Jaudzems, K Wthrich - Journal of molecular biology, 2010 - Elsevier
     

    Protein Summary

    The gene 29837500 from Sars coronavirus encodes nsp7 protein, a subunit of a SARS virus transcription complex PF08716.  The protein belongs to the class of all alpha  proteins, and reveals immunoglobulin/albumin-binding domain-like fold type SCOP46996.  The nsp7 forms the hexadecameric supercomplex with nsp8 2AHM [Ref].  The supercomplex is a unique hollow, cylinder-like structure assembled from 8 copies of nsp8 and held tightly together by 8 copies of nsp7. With an internal diameter of approximately 30 angstroms, the central channel has dimensions and positive electrostatic properties favorable for nucleic acid binding, implying that its role is to confer processivity on RNA-dependent RNA polymerase. 

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch