The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the Klebsiella pneumoniae protein YP_001336205. To be Published
    Site JCSG
    PDB Id 2l1s Target Id 390050
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS7663,YP_001336205.1, 91427 Molecular Weight 9432.11 Da.
    Residues 82 Isoelectric Point 5.07
    Sequence aagidqyalkeftadftqfhigdtvpamyltpeynikqwqqrnlpapdagshwtymggnyvlitdtegk ilkvydgeifyhr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2l1s
    1. The J-UNIO protocol for automated protein structure determination by NMR in solution
    P Serrano, B Pedrini, B Mohanty, M Geralt - Journal of biomolecular , 2012 - Springer

    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch