.
The Open Protein Structure Annotation Network
PDB Keyword
.

2l6n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution structure of the protein YP_001092504.1. To be Published
    Site JCSG
    PDB Id 2l6n Target Id 374407
    Molecular Characteristics
    Source Shewanella sp. pv-4
    Alias Ids TPS6751,YP_001092504.1, PF06155, 92176 Molecular Weight 14754.08 Da.
    Residues 131 Isoelectric Point 9.01
    Sequence mtpqsdtpkvtglklkrksrqleisfdngqqftlscellrvyspsaevhghgnpvlvthkknvninait pvgnyavklvfddghdtglyswkvlydlasnqvdlwenylarlraakasreplidmavkyht
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2l6n
    1. The J-UNIO protocol for automated protein structure determination by NMR in solution
    P Serrano, B Pedrini, B Mohanty, M Geralt - Journal of biomolecular , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch