.
The Open Protein Structure Annotation Network
PDB Keyword
.

2la7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the protein YP_557733.1 from Burkholderia xenovorans. To be Published
    Site JCSG
    PDB Id 2la7 Target Id 396231
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS63481,YP_557733.1, PF03724, 326152 Molecular Weight 15398.38 Da.
    Residues 145 Isoelectric Point 6.30
    Sequence ipkhpdseavapdpfnpaatqllddtswvlsawkqadgtaravpsadqgapitltlststgqrhasgfs gcnrymgsyalkdgklsfgtlggtrmacmtpggqiegaylnalthidrtgvqmrapqqmqlvldngdtl tfdrstr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2la7
    1. The J-UNIO protocol for automated protein structure determination by NMR in solution
    P Serrano, B Pedrini, B Mohanty, M Geralt - Journal of biomolecular , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch