.
The Open Protein Structure Annotation Network
PDB Keyword
.

2lr4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the protein NP_390037.1 from Bacillus subtilis. To be Published
    Site JCSG
    PDB Id 2lr4 Target Id 416576
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS66787,NP_390037.1, 327248 Molecular Weight 14201.48 Da.
    Residues 127 Isoelectric Point 8.75
    Sequence aealplyylqitgitsdgndfawdnltssqtkapnvlkgnklyvkarfmgytkltvitgkdgknllyng takmfksdailgqnkvvigwdkyfeipmdalqdnsiqikalssgttfvysqkidfere
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch