.
The Open Protein Structure Annotation Network
PDB Keyword
.

2lr6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of a LINE-1 type transposase domain-containing protein 1 (L1TD1) from Homo sapiens. To be Published
    Site JCSG Biology Target:
    PDB Id 2lr6 Target Id 421449
    Related PDB Ids 3soo 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS66968,BC111559 Molecular Weight 9841.82 Da.
    Residues 87 Isoelectric Point 5.14
    Sequence vlmdegavltlaadlssatldiskqwsnvfnilrendfepkflcevklafkcdgeiktfsdlqslrkfa sqkssmkellkdvlpqke
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch