.
The Open Protein Structure Annotation Network
PDB Keyword
.

2lyx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the protein NP_390345.1 from Bacilus subtilis. To be Published
    Site JCSG
    PDB Id 2lyx Target Id 416558
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS66779,NP_390345.1, 327289 Molecular Weight 10256.37 Da.
    Residues 86 Isoelectric Point 9.36
    Sequence eetplvtarhmskweeiavkeakkryplaqvlfkqkvwdrkrkdeavkqyhltlregskefgvfvtisf dpysqkvnkiaileeyq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch