.
The Open Protein Structure Annotation Network
PDB Keyword
.

2m3d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the GUCT domain from human DEAD box polypeptide 21 (DDX21). To be Published
    Site JCSG Biology Target:
    PDB Id 2m3d Target Id 423981
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS77085,BC008071, _0000.000363_ Molecular Weight 10570.59 Da.
    Residues 94 Isoelectric Point 5.66
    Sequence hisgatsvdqrslinsnvgfvtmilqcsiempnisyawkelkeqlgeeidskvkgmvflkgklgvcfdv ptasvteiqekwhdsrrwqlsvate
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch