The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of hypothetical protein BT_0846 from Bacteroides thetaiotaomicron VPI-5482 (NP_809759.1). To be Published
    Site JCSG
    PDB Id 2m4l Target Id 417790
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS75120,NP_809759.1, 323416 Molecular Weight 11174.75 Da.
    Residues 98 Isoelectric Point 4.52
    Sequence edwtelnsnniigywstgiegthkllsfdedgtgsfgiysnatpisfqmfdykieegriyiydvypdek tpyyldckisgttlkvetgseagtykkqk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch