The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the protein YP_002937094.1 from Eubacterium rectale. To be Published
    Site JCSG
    PDB Id 2mca Target Id 419666
    Molecular Characteristics
    Source Eubacterium rectale atcc 33656
    Alias Ids TPS82909,YP_002937094.1 Molecular Weight 11288.88 Da.
    Residues 102 Isoelectric Point 4.74
    Sequence aqdgketttirlinqtyfnvknikvtwndgkeqtvntlgshdsidfssdagsvykmdvtgttqsgekft ghfkglvgkdtrvfieldenadvqvfipqgeid
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch