.
The Open Protein Structure Annotation Network
PDB Keyword
.

2me0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens solved in the presence of the DNA sequence CGACTAATTAGTCG. To be Published
    Site JCSG Biology Target:
    PDB Id 2me0 Target Id 424577
    Related PDB Ids 2m34 2me6 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS76887,NM_001098834 Molecular Weight 8240.17 Da.
    Residues 70 Isoelectric Point 10.78
    Sequence apggksrrrrtaftseqllelekefhckkylsltersqiahalklsevqvkiwfqnrrakwkrikagnvs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch