.
The Open Protein Structure Annotation Network
PDB Keyword
.

2mhd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR strucutre of the hypothetical protein BACUNI_03114 from Bacteroides uniformis ATCC 8492. To be Published
    Site JCSG
    PDB Id 2mhd Target Id 417984
    Molecular Characteristics
    Source Bacteroides uniformis atcc 8492
    Alias Ids TPS83452,ZP_02071672.1, 323338 Molecular Weight 12739.64 Da.
    Residues 109 Isoelectric Point 4.83
    Sequence deddkveipqlvgkwivkepvlqddfvtcytfnadktyevytgsplsngvpfrgtyiisldekliklyd keehcteqyhilkltskemkwenaspkdgnsdkrlekynd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch