.
The Open Protein Structure Annotation Network
PDB Keyword
.

2mhe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the protein NP_419126.1 from Caulobacter crescentus. To be Published
    Site JCSG
    PDB Id 2mhe Target Id 423832
    Molecular Characteristics
    Source Caulobacter crescentus cb15
    Alias Ids TPS74913,NP_419126.1, 86 Molecular Weight 8229.93 Da.
    Residues 74 Isoelectric Point 6.16
    Sequence mpdkqllhivvggelkdvagvefrdlskvefvgaypsydeahkawkakaqatvdnaharyfiihahkll dpseg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch