.
The Open Protein Structure Annotation Network
PDB Keyword
.

2mhn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the first RRM domain of the protein RBM39 from Homo sapiens. To be Published
    Site JCSG
    PDB Id 2mhn Target Id 430174
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS83438,NM_184234 Molecular Weight 10232.23 Da.
    Residues 91 Isoelectric Point 9.99
    Sequence nltpeerdartvfcmqlaarirprdleeffstvgkvrdvrmisdrnsrrskgiayvefvdvssvplaig ltgqrvlgvpiivqasqaeknr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch