.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ml5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of hypothetical protein ZP_02064002.1 from Bacteroides ovatus ATCC 8483. To be Published
    Site JCSG
    PDB Id 2ml5 Target Id 419407
    Molecular Characteristics
    Source Bacteroides ovatus atcc 8483
    Alias Ids TPS73033,ZP_02064002.1 Molecular Weight 17885.03 Da.
    Residues 154 Isoelectric Point 4.55
    Sequence dselttqdgedfksfldkftssaafqytrvkfplktpitlladdgetektfpftkekwplldsetmkee ritqeeggiyvskftlnepkhkifeagyeesevdlrvefelqadgkwyvvdcytgwygydlpigelkqt iqnvkeenaafkeihp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch