.
The Open Protein Structure Annotation Network
PDB Keyword
.

2msn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title NMR structure of a putative phosphoglycolate phosphatase (NP_346487.1) from Streptococcus pneumoniae TIGR4. To be Published
    Site JCSG
    PDB Id 2msn Target Id 359637
    Related PDB Ids 2go7 
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS1425,NP_346487.1, 85241 Molecular Weight 23489.09 Da.
    Residues 206 Isoelectric Point 4.61
    Sequence mqktafiwdldgtlldsyeailsgieetfaqfsipydkekvrefifkysvqdllvrvaedrnldvevln qvraqslaeknaqvvlmpgarevlawadesgiqqfiythkgnnaftilkdlgvesyfteiltsqsgfvr kpspeaatylldkyqlnsdntyyigdrtldvefaqnsgiqsinflestyegnhriqaladisrifetk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene SP2064 from Streptococcus pneumoniae tigr4 encodes the NP_346487 protein, a putative phosphoglycolate phosphatase (99% sequence identity with a homologue from Streptococcus pneumoniae Hungary19A-6) EC:3.1.3.18, and member of the haloacid dehalogenase(HAD)-like hydrolases superfamily PF00702. The enzyme participates in glyoxylate and dicarboxylate metabolism.

    The enzyme catalyzes the following reaction: 2-phosphoglycolate + H(2)O <=> glycolate + phosphate.  

    2go7 belongs to the class of alpha and beta (a+b) proteins and adopts a  HAD-like fold type SCOP56783.  As detected by DALI, several similar structures of the enzyme homologues from different organism have been determined: 2yy6 (Z=23);  2HDO (Z=21), Lactobacillus plantarum; 1TE2 (Z=19), Escherichia coli; 1WR8 (Z=11), Pyrococcus horikoshii.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch