.
The Open Protein Structure Annotation Network
PDB Keyword
.

2mvb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of hypothetical protein NP_344732.1 from Streptococcus pneumoniae TIGR4. To be Published
    Site JCSG
    PDB Id 2mvb Target Id 417539
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS74838,NP_344732.1, 327970 Molecular Weight 18373.80 Da.
    Residues 165 Isoelectric Point 5.54
    Sequence gpatktekdtlqsalpvienaekntvvtktlvlpksddgsqqtqtitykdktflslaiqqkrpvsdelk tyidqhgveetqkalleaeekdksiiearklagfkletkllsatelqtttsfdfqvldvkkasqlehlk niglenllknepskyisdrlangateq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch