.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o2x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_103874.1) from Mesorhizobium loti at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 2o2x Target Id 366936
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS1492,NP_103874.1, 90897 Molecular Weight 23198.36 Da.
    Residues 217 Isoelectric Point 5.38
    Sequence madktgtphpltepgvwieriggrvfpphlpalfldrdgtinvdtdypsdpaeivlrpqmlpaiatanr agipvvvvtnqsgiargyfgwsafaavngrvlellreegvfvdmvlacayheagvgplaipdhpmrkpn pgmlveagkrlaldlqrslivgdkladmqagkraglaqgwlvdgeaavqpgfairplrdsselgdllaa ietlgrdnrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.167
    Matthews' coefficent 1.99 Rfactor 0.138
    Waters 329 Solvent Content 38.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o2x
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Structural determinants of substrate recognition in the HAD superfamily member D-glycero-D-manno-heptose-1, 7-bisphosphate phosphatase (GmhB)
    HH Nguyen, L Wang, H Huang, E Peisach - Biochemistry, 2010 - ACS Publications
     

    Protein Summary

    Gene mll2559 from Mesorhizobium loti encodes the NP_103874 protein that has sequence similarity to HisB, histidinol phosphatase and polynucleotide kinase phosphatases (COG0241; PF08645). Predicted functional associations based on genome context are as follows (string.embl.de): mll2561 (Probable phosphoheptose isomerase), rfaE (Bifunctional protein hldE), mll1559 (UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diamino), mlr3529 (Probable 1-acyl-SN-glycerol-3-phosphate), glyS (Glycyl-tRNA synthetase beta chain (EC 6.1.1.14)), glyQ (Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)), mlr2566 (ADP-heptose-LPS heptosyltransferase), mll2564, mlr7550 (Glucose-1-phosphate thymidylyltransferase), and Mlr5068.

    SCOP classifies 2o2x in the alpha/beta class, HAD-like superfamily, histidinol phosphatase-like family. DALI detects structural similarity with the heptose phosphatase PDB:3l1u and PDB:2gmw (Z=23), the histidinol phosphate phosphatase ( PDB:2fpr; Z-score 17.6; RMSD 2.5), and the 5'-polynucleotide kinase-3' phosphatase FHA domain PDB:1yj5 (DNA repair enzyme; Z=17).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch