.
The Open Protein Structure Annotation Network
PDB Keyword
.

2own

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of oleoyl thioesterase (putative) (NP_784467.1) from Lactobacillus plantarum at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2own Target Id 366924
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS1490,NP_784467.1, PF01643, 86122 Molecular Weight 29917.32 Da.
    Residues 261 Isoelectric Point 5.13
    Sequence matlganaslyseqhrityyecdrtgratlttlidiavlasedqsdalglttemvqshgvgwvvtqyai ditrmprqdevvtiavrgsaynpyfayrefwirdadgqqlayitsiwvmmsqttrrivkilpelvapyq sevvkriprlprpisfeatdttitkpyhvrffdidpnrhvnnahyfdwlvdtlpatfllqhdlvhvdvr yenevkygqtvtahanilpsevadqvttshlievddekccevtiqwrtlpepiq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.242
    Matthews' coefficent 3.17 Rfactor 0.204
    Waters 443 Solvent Content 61.22

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2own
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Thioesterases: A new perspective based on their primary and tertiary structures
    DC Cantu, Y Chen, PJ Reilly - Protein Science, 2010 - Wiley Online Library
     
    3. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    4. Phylogenetic and experimental characterization of an acyl-ACP thioesterase family reveals significant diversity in enzymatic specificity and activity
    F Jing, DC Cantu, J Tvaruzkova, JP Chipman - BMC , 2011 - biomedcentral.com
     
    5. Structural and functional analyses of a saturated acyl ACP thioesterase, type B from immature seed tissue of Jatropha curcas
    KG Srikanta Dani, KS Hatti, P Ravikumar - Plant Biology, 2011 - Wiley Online Library
     

    Protein Summary

    The fat (lp_0708) gene encodes the NP_784467.1 amino acid sequence that folds as a 261 residues long protein belonging to the Acyl Acyl-Carrier-Protein Thioesterase family (PF01643). It is composed of two 4-hydroxybenzoate thioesterase (4HBT) domains, from positions 10 to 120 and from 160 to 250. There are more than 500 sequences with this architecture present in all kingdoms. It crystallizes as a dimer, with an unknown ligand bound on equivalent positions on both A and B chains involving residues S45, W62, G87, A95 and R97, all part of the first 4HBT domain.

     

    SCOP classifies 2own inside the alpha+beta class, thioesterase/thiol ester dehydrase-isomerase superfamily, Acyl-ACP TE-like family. Top hits in HHpred and FFAS are 2ess, which corresponds to the equivalent enzyme in B. thetaiotamicron, and 1s5u, containing one single 4HBT domain. Dali and FATCAT corroborate the same hits with these values: 2ess (Z-scr=27.1; P-val=7e-12); 1s5u (Z-scr=18.6; P-val=5.5e-16).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch