The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein (YP_388795.1) from Desulfovibrio desulfuricans G20 at 1.94 A resolution. To be published
    Site JCSG
    PDB Id 2q30 Target Id 366877
    Molecular Characteristics
    Source Desulfovibrio desulfuricans g20
    Alias Ids TPS1485,YP_388795.1,, 92781 Molecular Weight 11894.06 Da.
    Residues 109 Isoelectric Point 5.06
    Sequence meahmkshnlleavrfddqrfvmelvhesenfkivsftfkagqelpvhshniegelnivvlegegefvg dgdavipaprgavlvapistphgvravtdmkvlvtiappi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.94 Rfree 0.212
    Matthews' coefficent 2.21 Rfactor 0.167
    Waters 654 Solvent Content 44.45

    Ligand Information



    Protein Summary

    The Dde_2303 gene codifies for the YP_388795 amino acid sequence that belongs to the Cupin-2 group (PF07883) containing the conserved motif AGxxxxxHxH.


    2q30 classifies inside the SCOP all beta class, RmlC-like cupins superfamily, TM1287-like family. The closest structural similarity detected is with PDB:1v70 (FFAS scr=-35; Dali Z-scr=16), PDB:1yhf (FFAS scr=-41; Dali Z-scr=14) and PDB:3h8u (FFAS scr=-33; Dali Z-scr=15); all three proteins with unknown functions.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch