The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative methyltransferase (ZP_00558420.1) from Desulfitobacterium hafniense Y51 at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 2qne Target Id 360990
    Molecular Characteristics
    Source Desulfitobacterium hafniense dcb-2
    Alias Ids TPS1458,DHAF_12NOV03_CONTIG1082_REVISED_GENE2974, PF06253, 291496 Molecular Weight 52257.77 Da.
    Residues 476 Isoelectric Point 5.46
    Sequence llpkyniltedqvqkihentmkileeigiefeyepalevfrregqkvegkrvyltrefvesklksapae ftlharnpennvviggdnivfmpgygapfiyeldgsrrkttlqdyenfaklagasknmhlsggtmaepq dipdgvrhlqmlyssiknsdkcfmgsaegkeraedsveiaailfggkdvikekpvlvslinsltplkyd ermlgalmayaeagqaviiaslvmagstgpaslagtlslqnaevlagislaqsinpgtpviygstsals dmrsgslsigspecalfisasaqlarfygvpsrsggglndsktvdaqagyesmmtlmaanltgvnfvlh tagilqyfmamsyekfimddeiagmllhymkgytfdedgmafdviekvgpgghfltqkhtrknhkrefy tptlsdrsaydtwakekletkqraharwqqilanyvppaldpeidaklqafiaqrgkevgee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.204
    Matthews' coefficent 2.45 Rfactor 0.158
    Waters 145 Solvent Content 49.75

    Ligand Information



    Protein Summary

    The gene ZP_00558420.1 from Desulfitobacterium hafniense encodes putative trimethylamine methyltransferase (MTTB) PF06253.  The enzyme is involved in methanogenesis.  The catalyzed reaction is the methyl group transfer from trimethylamine (TMA) to different cognate corrinoid proteins that are subsequently used to methylate coenzyme M (CoM) [Ref].  The enzyme is structurally related to monomethylamine methyltransferase from Methanosarcina barkeri  1NTH and reveals TIM beta/alpha-barrel fold type SCOP51350.

    Ligand Summary





    1. (No Results)


      Discuss this publication
    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch