.
The Open Protein Structure Annotation Network
PDB Keyword
.

353973

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 353973
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS89148,6459780 Molecular Weight 38053.98 Da.
    Residues 353 Isoelectric Point 6.74
    Sequence mtgrrcerttspgtggrlraepadfqvqevpaylpggsgeylylhvektrhttahvvrelcaqlgvrdr dvgvaglkdrhavttqwlslpakveprmgdfslpgvriletsrhtnklgmghlhgnrfvvrvrgaagma eqagetlatlaqggvpnyfgpqrfglgglnaeeglrvlrgeselrdprvrrfltssvqsaifnalvslr lerevfdrlltgdmakkhdtggvflvedagaetpraqrgevsatgtlfgrkvkpltadagaleaealal fglspqvfasrkgdrrlirvfpaeaevrpeddgyvlaftlpkgsfatsvlrevmktevdapgagpdttd egeagdge
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch