.
The Open Protein Structure Annotation Network
PDB Keyword
.

353975

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 353975
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS2383,6460006 Molecular Weight 21855.29 Da.
    Residues 203 Isoelectric Point 5.13
    Sequence mtdlpppfttlaaahrvdavidhseflafaeradspeealahlaalrtrypdathhcwayrigaayrfg ddgepggtagapilraiegqgvdhvmvvvvryyggvklgtgglvrayggvaaeclrtaprldvrprrtl qvsvpfdhlsglyhllgtwdaargeetytgagvtlpvevypedveafqaalrdatrgsavveeee
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch