.
The Open Protein Structure Annotation Network
PDB Keyword
.

353986

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 353986
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS89172,13813877 Molecular Weight 15260.06 Da.
    Residues 138 Isoelectric Point 10.31
    Sequence msekiqvlgsrkgltpalqhysvvnvadnsggkeamiigvygyrgvlrrvpfaniadmvmvsikkgtpe vrkqkfravivrqrmpyrrpdgtwisfednavviinpdgtpkgtevrgpiareaaerwpkiaslatlvv
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch