The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 353997
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS89194,13815749 Molecular Weight 40190.67 Da.
    Residues 352 Isoelectric Point 9.20
    Sequence mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagipiveakkilp navylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyreaynlgleiknkilekeki tvtvgisknkvfakiaadmakpngikviddeevkrlireldiadvpgignitaeklkklginklvdtls iefdklkgmigeakakylislardeynepirtrvrksigrivtmkrnsrnleeikpylfraieesyykl dkripkaihvvavtedldivsrgrtfphgisketaysesvkllqkileederkirrigvrfskfieaig ldkffdt
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch