.
The Open Protein Structure Annotation Network
PDB Keyword
.

354050

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 354050
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS89302,10640283, PF00329 Molecular Weight 17519.84 Da.
    Residues 150 Isoelectric Point 4.89
    Sequence mdiiaeektkdgrkvirvakenlldlmkelksqgynlslttavdyvdhievvyhlynmqkneyiivkte trdnhvpsltslwnaanwdereeydlvgvifdghpnlkrlflpegwvghplrknydlskaqyvnmdeeg ndyvtfdpeggw
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch