.
The Open Protein Structure Annotation Network
PDB Keyword
.

354103

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 354103
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS89404,CE09624 Molecular Weight 51412.78 Da.
    Residues 462 Isoelectric Point 5.85
    Sequence mslgqlsytpvtdvgigaielyfpqnfvdqndlekfnnvssgkytiglgqqqmgfcsdnedivsisltv trklietykistdsigclvvgtetmidksksvktalmdlfpgnsdiegvdiknacfggaqallhaidwv tvnhpldkknaivvvadiaiyeegparctggagaiaflicpdasipidrqfsachmkntwdffkpitpi pseypvvdgslslssyleavrmtytyfiskvnrhttgidglnsfdgvflhspftkmvqkglavmnytds qlrhkqlngngvdhkldendraglakmielsaqvwkektdpylvfnrrignmytpslfaqllaylaadd cvtgeksilffaygsglasaifpgrvrqtsnldkirqvairaikrlddriqftpeeftetlqkrevflr skeipkspsetslfpntyfldnmdklyrrsytlheepngvqngngihh
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch