.
The Open Protein Structure Annotation Network
PDB Keyword
.

354119

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 354119
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS89436,YLR299W Molecular Weight 73305.11 Da.
    Residues 661 Isoelectric Point 5.56
    Sequence mllcnrkvpktlntcfilhiftlltlgvlvsgmpskmvsfasqetlqrinnllrgsanrdvdiiaeylk kdddddggdkdhhnididplprrpsltpdrqllkvglhgaissdlevcsnltinevllkfpgsnaadaa vtqalckgmvnffnsgiggggyvvfsgkddedhlsidfrekapmdshkfmfencslcskigglavgvpg elmglyrlfkergsgqvdwrdliepvaklgsvgwqigealgatlelyedvfltlkedwsfvlnsthdgv lkegdwikrpalsnmlmelakngsvapfydpdhwiaksmidtvakyngimnlqdvssydvhvtkplsmk irkganfipdndmtvltssgsssgaallaalrimdnfqnqeggdyekettyhllesmkwmasarsrlgd fegealpkhieevldpewalkavksikrnsqdgnfktlenwtlydpaydinnphgtahfsivdshgnav sltttinllfgslvhdpktgvifnnemddfaqfnksnsfelapsiynfpepgkrplsstaptivlselg ipdlvvgasggsrittsvlqtivrtywynmpiletiayprihhqllpdrielesfpmigkavlstlkem gytmkevfpksvvnairnvrgewhavsdywrkrgissvyz
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch