.
The Open Protein Structure Annotation Network
PDB Keyword
.

354159

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 354159
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2823,TM1781 Molecular Weight 46010.81 Da.
    Residues 398 Isoelectric Point 6.16
    Sequence mseklwekgykvneevekftvgddyitdmkiieydikasivhsrmlhkigllsaeeqkkieealselln lvkegkfqikpeeedchtaienflvkklgeigkkihtarsrndqvltalrlmykeelkeienlirelqk slerfiekfgdvkfpgythtrkamptdfatwagalkdaleddlkllktayeivdqsplgtgagygvpid idreftakelgfskvqwnpiytqnsrgkfeylilhtlsqisydlnrfasdiiffslpeigylklpkelc tgssimphkinpdplelvrahhhtivskmlmavtlpsnlifgyhrdfqllkkpvieafevvknivrimk iifdhlevdkersessiteevlathrvyelvkqgvpfrdayrmvaekygrekd
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1781

    Name: argininosuccinate lyase
    Metabolic Subsystem: Arginine Biosynthesis
    Reaction: : argsuc <==> arg-L + fum
    Classification: EC:4.3.2.1
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1781
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch