The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 354172
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS89500,15023383 Molecular Weight 46525.51 Da.
    Residues 424 Isoelectric Point 4.99
    Sequence miiikngyvidpltkregkfdilidgenvvrisqdigidddievidaedcivspgfidihshfrdpgft ekediitgaraaarggyttvicmantnpvvdnvetlryivdkaktakievlqvgtitkgmqgvelvdme alkeagavgfsddgkpimdsrlvleamqkareldvplsfheedpklvyesginggkvaeklnmmgalee aetvltardaalavssgaktniqhisskislgiiklakemganiiaeatpqhfsiteeeilncgtnakv npplrreddrkaivaalkddtiqviatdhaphtkdekarefkeapsgmigletalslavtnlvktgdlt yrdmiskltinparfynldrgyikeghradivifdpdekytvkeeefqskasnspfigkelfgkvktti yngkivyedk
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch