The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 354206
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS89566,2633247 Molecular Weight 24673.82 Da.
    Residues 220 Isoelectric Point 4.82
    Sequence mikalifdfdglildtetheyevlqeifeehgsvlplsvwgkvigtaagfrpfeyleeqigkklnheel tqlrrerfakrmesekarpgveaylnaakdlglkiglasssdykwvsghlkqiglfddfeviqtaddve evkpnpelyllaaknlgvspaeclafedsvngsiaakragmkcvivpnkvtgtlmfedydhrlesmaem elallldhlnsqn
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch