.
The Open Protein Structure Annotation Network
PDB Keyword
.

354212

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 354212
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS89578,15160206 Molecular Weight 27942.40 Da.
    Residues 247 Isoelectric Point 7.85
    Sequence msdtqwlewgrknpyygvysedrfntsnieltkseffetgeanvswmlgraeqhfgplgkgrvlefgag varmsiplasrfeavvgvelspdmraealkncqlynvsnvemvpsdddlshaegeydlvlsyivlqhmd arrgvllidkllskvgpngvailqtsvrrperrladrlryylrhnvpalaatyrflrgkgwstlsmrms eydpiailaafsrngmkdvllsqhyqgdvltfhftarkgg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch