.
The Open Protein Structure Annotation Network
PDB Keyword
.

354282

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 354282
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS89706,1789237 Molecular Weight 51500.93 Da.
    Residues 465 Isoelectric Point 6.10
    Sequence mefamrvlikngtvvnadgqakqdlliesgivrqlgnnispqlpyeeidatgcyvfpggvdvhthfnid vgiarscddfftgtraaacggtttiidhmgfgpngcrlrhqlevyrgyaahkavidysfhgviqhinha ildeipmiveeglssfklyltyqyklnddevlqalrrlhesgalttvhpendaaiaskraefiaaglta pryhalsrpleceaeaiarminlaqiagnaplyivhlsnglgldylrlaranhqpvwvetcpqylllde rsydtedgmkfilspplrnvreqdklwcgisdgaidvvatdhctfsmaqrlqiskgdfsrcpnglpgve nrmqllfssgvmtgritperfveltsamparlfglwpqkgllapgsdgdvviidprqsqqiqhrhlhdn adyspwegftcqgaivrtlsrgetifcdgtftgkagrgrflrrkpfvppvl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch