The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 354300
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS89740,17132111 Molecular Weight 38370.43 Da.
    Residues 340 Isoelectric Point 7.52
    Sequence mrrntithefdqgepkeslvppendnrsseasqllrqgiqqqqagdlitaikslqqslemfqlardvkq qeqvlsllalitytsgdyrnviaycqkclsltdnpdlsvrmqilshlgnayrhlndynkaieflqaclq ltqtlqdkrsqvaalnnlglvykasgnfnqaigyqeqsliiveelkdswgieqvlknlgntwyaldnyp kaiayyekcvkialslnnprsaaqvlknlgnacyaigdyakaikyyekrwqlardlkdkrseeqslgsl gvtcealgdhsraityyearlllarsikdkrieeqalaslkiacyalgdyakamqyeqgtstst
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch