The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 354313
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS89766,15157405 Molecular Weight 23445.21 Da.
    Residues 210 Isoelectric Point 5.11
    Sequence mtmttlkgftasdfrrrvlqegegvaerengdhvlnpgvvlsgngirlkdaavlipviddgndarvift qrtatlrqhsgqisfpgggidaedrtpeeaalreteeeiglsrsfvetvgrlpdyisgtgfrikpvlsv vrpgfdltlnptevdevfevplsflmdpanhgrgsrifqgkerffyempygeryiwgitagivrtiyer fyt
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch