.
The Open Protein Structure Annotation Network
PDB Keyword
.

354317

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 354317
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS74170,15156516 Molecular Weight 17628.27 Da.
    Residues 151 Isoelectric Point 6.31
    Sequence mpqfethrlvkhspdrmydlvadvekypqflplcealsvrsrkerdgkvllvadmtvgykairetfttq vllnpaeraidvkyidgpfryldnrwrfeaaenggttihffidyefknrllgavmgsmfdrafrmfaea fetradkiytdpa
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch