.
The Open Protein Structure Annotation Network
PDB Keyword
.

354323

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 354323
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS89780,15159667 Molecular Weight 31995.56 Da.
    Residues 296 Isoelectric Point 8.44
    Sequence mivaliihrpltkrqkmvaydveqlegkvrgallqgtnsgktgvivlggssgrvdttraglfantgara lalqwfgganqppgiceipletfvdatdllisrgcdrtvfvgtskgaeaallastidhrinvviaisps svvlgnigagvdgiswpersswsfkrspldfvpadinwqkdyrdglvsyrsffekclsndvqlnerari pvesspadlilvaggddalwpsgyfarqilqsrqahgrqatlifdkdaghrillpgettqrsklhahgg sdeadaklgqnawrairell
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch