.
The Open Protein Structure Annotation Network
PDB Keyword
.

354356

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 354356
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS89840,2648367 Molecular Weight 36022.97 Da.
    Residues 324 Isoelectric Point 5.04
    Sequence mkpqpllliaiallcccvtdegdkitslgkiadesivyvwwsvkaedrvylglgtvdgtsfaefhppnr leillssedfsqreaavwdgeeilifggtvfengkysptdqilsfnpklerlrvlnaslphptsdvaav wgdsrvyiflnnsercevyafypsnesfakldvscpiehpggcvhsvvwyggkayffcgegvasfdpmg gfkwiaftdrvwvraatvadgyifaiggssgiaetkdeiirfnpktgelcemrtklpvargqavavgge yiyifggytkdgyaneilrydyrgdkcvnfiqllnddvkkyrpnngkq
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch