.
The Open Protein Structure Annotation Network
PDB Keyword
.

354369

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 354369
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS89864,1790021 Molecular Weight 31871.80 Da.
    Residues 280 Isoelectric Point 8.65
    Sequence msntyqkrkaskeyglynqckklnddelfrllddhnslkrissarvlqlrggqdavrlaiefcsdknyi rrdigafilgqikickkcednvfnilnnmalndksacvrataiestaqrckknpiyspkiveqsqitaf dkstnvrratafaisvindkatipllinllkdpngdvrnwaafaininkydnsdirdcfvemlqdknee vrieaiiglsyrkdkrvlsvlcdelkkntvyddiieaagelgdktllpvldtmlykfddneiitsaidk lkrs
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch