.
The Open Protein Structure Annotation Network
PDB Keyword
.

354385

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 354385
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS89896,17129930 Molecular Weight 37794.42 Da.
    Residues 324 Isoelectric Point 6.36
    Sequence mnigsmdiqkigmitsyrnlakradwlwqqtpqqfgiwqniqiqalsgkpdfllmyqfdfpkdnqqtsl idklrqklqnpqvnvesllrdvpkekiiyllreppldeiveknkryyqeakkycgyisgpddfapkpdy mpaiwyhnnsfrelnempvpekvfpcswitsgisrtvnhrrrlkfveliqasevkcdvygrdlpiwaks lgelgnkwygmapyyynlsienyadndwyvseklwdallawclpiyyggpaadkllppgsflrlpslde kgiayiqevtatpdawyaakdaiaearqlilhklnllnwlsefvtqfs
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch