.
The Open Protein Structure Annotation Network
PDB Keyword
.

354427

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 354427
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS89976,15023509 Molecular Weight 41238.91 Da.
    Residues 361 Isoelectric Point 6.12
    Sequence mdtnykmlyekyeklknefstyqnfaetqiqrmngkntelekkldiltnvievskyinsnisddnlvpm indmiigilgvtystiylveddeklivkasnvmdnydiivnpvfstfsdnrpivinskeplfkefknkl kvhsiigvpitlrdnfrgyiivehtlydffshghikfissianqiaiaiensflykkvkessikdpflg iynrkhffdmiegkvakdsrrsfaivmldidhfksfndsyghqfgdevliqtakileqsigekdevary ggeeivlylndaqskekvfktvdgiraslsnnsvrhggiekrvtasfgisyypqngetvekvvsvadam lyeaknsgrnkvvssl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch