.
The Open Protein Structure Annotation Network
PDB Keyword
.

354649

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 354649
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS90366,17028413 Molecular Weight 58436.68 Da.
    Residues 515 Isoelectric Point 6.45
    Sequence mgsemepllrawsyfrrrkfqlcadlctqmlekspydqepapdlpvsqaawilkaraltemvyideidv dqegiaemildenaiaqvprpgtslklpgtnqtggptqavrpitqagrpitgflrpstqsgrpgtmeqa irtprtaytarpitsssgrfvrlgtasmltspdgpfinlsrlnltkysqkpklakalfeyilhhendvk maldlaslsteysqykdwwwkvqigkcyyrlgmyreaekqfksalkqqemvdtflylakvyiildqpvt alnlfkqgldkfpgevtllcgiariyeemnnsssaaeyykevlkqdnthveaiacigsnhfysdqpeva lrfyrrllqmgvyncqlfnnlglccfyaqqydmtltsferalslaeneeeaadvwynlghiavgigdtn lahqcfrlalvhnnhhaeaynnlavlemrkghveqarallqtasslaphmyephfnfatvsdkigdlqr syvaaqksevafpehvdtqhlikqlkqhfaml
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch