.
The Open Protein Structure Annotation Network
PDB Keyword
.

354678

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 354678
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS90416,17391046 Molecular Weight 66851.83 Da.
    Residues 585 Isoelectric Point 6.44
    Sequence maavelewipetlyntaisavvdnyirsrrdirslpeniqfdvyyklyqqgrlcqlgsefcelevfakv lraldkrhllhhcfqalmdhgvkvasvlaysfsrrcsyiaesdaavkekaiqvgfvlggflsdagwysd aekvflsclqlctlhdemlhwfraveccvrllhvrngnckyhlgeetfklaqtymdklskhgqqanraa lygelcallfakshydeaykwcveamkeitaglpvkvvvdvlrqaskacvvkrefkkaeqlikhavyla rdhfgskhpkysdtlldygfyllnvdnicqsvaiyqaaldirqsvfggknihvatahedlayssyvhqy ssgkfdnalfhaeraigiithilpedhlllasskrvkalileeiaidchnketeqrllqeahdlhlssl qlakkafgefnvqtakhygnlgrlyqsmrkfkeaeemhikaiqikeqllgqedyevalsvghlaslyny dmnqyenaeklylrsiaigkklfgegysgleydyrgliklynsignyekvfeyhnvlsnwnrlrdrqys vtdaledvssspqsteevvqsflmaqnvegpsc
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch