The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 354718
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS2415,17390337, 282761, 282286, 281887, 281867, 89707 Molecular Weight 47003.58 Da.
    Residues 425 Isoelectric Point 6.94
    Sequence matavvvnigkklyegktkevyelldtpgrvllqskdqitagnaarknhlegkaaisnkitscifqllq eagiktaftkkcgetafiapqcemipiewvcrriatgsflkrnpgvqegykfyppkvemffkddanndp qwseeqliaakfcfaglvigqtevdimshatqaifeilekswlpqdctlvdmkiefgvdvttkeivlad vidndswrlwpsgdrsqqkdkqsyrdlkevtpeglqmvkknfewvadrvelllksdsqcrvvvlmgsts dlghcekikkacgnfgipcelrvtsahkgpdetlrikaeyegdgiptvfvsvagrsnglgpvlsgntay pviscppitpdwgaqdvwsslrlpsgigcstilspegsaqfaaqifglnnhlvwaklrasilntwislk qadkkvrqcnl
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch