.
The Open Protein Structure Annotation Network
PDB Keyword
.

354720

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 354720
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS90492,13278309 Molecular Weight 52814.83 Da.
    Residues 452 Isoelectric Point 6.56
    Sequence mltcnkagsgmvvdaassngpfqpvallhirdvppadqeklfiqklrqccvlfdfvsdplsdlkwkevk raalsemveyithnrnvitepiypeavhmfavnmfrtlppssnptgaefdpeedeptleaawphlqlvy efflrflespdfqpniakkyidqkfvlqllelfdsedprerdflkttlhriygkflglrayirkqinni fyrfiyetehhngiaelleilgsiingfalplkeehkifllkvllplhkvkslsvyhpqlaycvvqfle kdstltepvvmallkywpkthspkevmflneleeildviepsefvkimeplfrqlakcvssphfqvaer alyywnneyimslisdnaakilpimfpslyrnskthwnktihgliynalklfmemnqklfddctqqfka eklkeklkmkereeawvkienlakanpqvlkkrvtrec
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch