The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 354721
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS90494,15277452 Molecular Weight 15671.01 Da.
    Residues 148 Isoelectric Point 5.66
    Sequence manlsrcnlahanlccanleradlsgsvldcanlqgvkmlcsnaegaslrlcnfedpsglkanleganl kgvdmegsqmtginlrvatlknaklkncnlrgatlagtdlencdlsgcdlqeanlrgsnvkgaifeeml tplhmsqsvr
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch