.
The Open Protein Structure Annotation Network
PDB Keyword
.

354958

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 354958
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS90924,YMR061W Molecular Weight 79956.43 Da.
    Residues 677 Isoelectric Point 5.62
    Sequence msssttpdllypsadkvaepsdnihgdelrlrerikdnptnilsyfqliqyletqesyakvrevyeqfh ntfpfyspawtlqlkgelardefetvekilaqclsgklenndlslwstyldyirrknnlitggqearav ivkafqlvmqkcaifepksssfwneylnfleqwkpfnkweeqqridmlrefykkmlcvpfdnlekmwnr ytqweqeinsltarkfigelsaeymkarslyqewlnvtnglkraspinlrtankknipqpgtsdsniqq lqiwlnwikwerenklmlsedmlsqrisyvykqgiqymifsaemwydysmyisensdrqnilytallan pdspsltfklsecyeldndsesvsncfdkctqtllsqykkiasdvnsgednnteyeqellykqrekltf vfcvymntmkrisglsaartvfgkcrklkrilthdvyvenaylefqnqndyktafkvlelglkyfqndg vyinkyldfliflnkdsqiktlfetsvekvqdltqlkeiykkmisyeskfgnlnnvyslekrfferfpq enlievftsryqiqnsnlikkleltymyneeedsyfssgngdghhgsynmsssdrkrlmeetgnngnfs nkkfkrdselptevldllsvipkrqyfntnlldaqklvnflndqveiptvestksg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch