.
The Open Protein Structure Annotation Network
PDB Keyword
.

354999

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 354999
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS90998,YLL036C Molecular Weight 56566.95 Da.
    Residues 503 Isoelectric Point 5.03
    Sequence mlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivpsaqqasltestnsa tlkanysipnlltslqnewdaimlenfklrstldsltkklstvmyerdaaklvaaqllmeknedskdlp kssqqavaitreeflqgllqssrdfvargklkapkwpilknlellqaqnysrniktfpykelnksmyyd kwvcmcrcedgalhftqlkdsktittittpnprtggehpaiisrgpcnrllllypgnqitildsktnkv lreievdsaneiiymyghnevnteyfiwadnrgtigfqsyeddsqyivhsaksdveyssgvlhkdslll alyspdgildvynlsspdqassrfpvdeeakikevkfadngywmvvecdqtvvcfdlrkdvgtlaypty tipefktgtvtydiddsgknmiaysnesnsltiykfdkktknwtkdeesalclqsdtadftdmdvvcgd ggiaailktndsfnivaltp
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch