The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 355051
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS91100,YDL086W Molecular Weight 30835.53 Da.
    Residues 273 Isoelectric Point 5.91
    Sequence mlitetfhdvqtsygttlriyvyspkiagypqakfpgvilyseiyqvtgpvrrfgqriasegyvvvapa iyhnfmgpealpydvqgtdigneykikkplesydednklccdllfqlpqfdgkrigstgmclgghlafr alldkrvtcatcffptdihsrtlglgqndnslervskelgnnqemvlifgtadthvdpqgrdlirktlr dhgvkftfleilaaqhafirdefskgrfdsaitqsclgflfeqfnrklridlgefvddntplehvc
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch